PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 253aa    MW: 29177 Da    PI: 4.9224
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030174genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.73.1e-4281363127
          NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                  +G rFhP++e+lv++yLk k+ g ++e+ ++i+ev+++k+ePw+Lp +   +++++e  wyf s+ d kya++kr+nr+tk+gyWk tgk++ v ++ 
  Lus10030174   8 VGWRFHPSEEQLVNHYLKLKMLGYDHEV-RHIAEVNVNKFEPWQLPgQassEADSDEPVWYFLSCPDYKYANSKRSNRTTKKGYWKPTGKERIVRAEs 104
                  79***********************999.88***************5444333445559*********************************999987 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyr 127
                  ++e++g+kktLvf+kgr p g+ktdW+mhey+
  Lus10030174 105 TNEEIGTKKTLVFHKGRVPGGVKTDWIMHEYK 136
                  7888***************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100542.9666155IPR003441NAC domain
SuperFamilySSF1019411.31E-457153IPR003441NAC domain
PfamPF023652.9E-228136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSSNVSRVGW RFHPSEEQLV NHYLKLKMLG YDHEVRHIAE VNVNKFEPWQ LPGQASSEAD  60
SDEPVWYFLS CPDYKYANSK RSNRTTKKGY WKPTGKERIV RAESTNEEIG TKKTLVFHKG  120
RVPGGVKTDW IMHEYKPLFS FPNQRDFLLY KLMDKSSSTT NDDDEEQPNV EGGESSTGMS  180
SNFPNPNPSS YENAPFPIEP REDSQLQADL DGFSGYDEMS YNLNSVMQQQ QQQQPWTWNT  240
DENLSYDHSF YG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-34915920169NO APICAL MERISTEM PROTEIN
1ut4_B2e-34915920169NO APICAL MERISTEM PROTEIN
1ut7_A2e-34915920169NO APICAL MERISTEM PROTEIN
1ut7_B2e-34915920169NO APICAL MERISTEM PROTEIN
3swm_A2e-34915923172NAC domain-containing protein 19
3swm_B2e-34915923172NAC domain-containing protein 19
3swm_C2e-34915923172NAC domain-containing protein 19
3swm_D2e-34915923172NAC domain-containing protein 19
3swp_A2e-34915923172NAC domain-containing protein 19
3swp_B2e-34915923172NAC domain-containing protein 19
3swp_C2e-34915923172NAC domain-containing protein 19
3swp_D2e-34915923172NAC domain-containing protein 19
4dul_A2e-34915920169NAC domain-containing protein 19
4dul_B2e-34915920169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301328.11e-71hypothetical protein POPTR_0002s15560g
TrEMBLB9GPV52e-71B9GPV5_POPTR; Uncharacterized protein
STRINGPOPTR_0002s15560.15e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.14e-43NAC transcription factor-like 9